(data stored in ACNUC1104 zone)

EMBL: FN667741.PSTS

FN667741.PSTS        Location/Qualifiers
FT   CDS             180218..181249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0039"
FT                   /gene="pstS"
FT                   /locus_tag="XBJ1_0188"
FT                   /product="high-affinity phosphate transport protein (ABC
FT                   superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79339"
FT                   /db_xref="GOA:D3UYG1"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79339.1"
FT                   /translation="MRTTVASIMAAALAMTSLSSFAASSLTGAGATFPAPVYTKWADSY
FT                   QKETGNKINYQGIGSSGGVKQIIAHTVDFGASDAPLSHEKLEADGLFQFPTVIGGIVLA
FT                   VNISGIKSGQLVLDGKTLGDIYLGNIKKWNDPAITKLNPGLRLPDQNIAVIRRADGSGT
FT                   SFVFTSYLSKVNSLWKEKVGVGSTVKWPAGLGGKGNDGIAAFVQRLPGSIGYVEYAYAK
FT                   QNNLAYTKLISADGKVVAPTEANFSAAAKGADWSKSFAQDLTAQKGDNVWPITSTTFIL
FT                   IHKQQKNAANGIEVLKFFDWAYEQGGKQAKDLDYSVLPQDVIGQIRAAWKRDIKDSSGN
FT                   PLY"
     MRTTVASIMA AALAMTSLSS FAASSLTGAG ATFPAPVYTK WADSYQKETG NKINYQGIGS        60
     SGGVKQIIAH TVDFGASDAP LSHEKLEADG LFQFPTVIGG IVLAVNISGI KSGQLVLDGK       120
     TLGDIYLGNI KKWNDPAITK LNPGLRLPDQ NIAVIRRADG SGTSFVFTSY LSKVNSLWKE       180
     KVGVGSTVKW PAGLGGKGND GIAAFVQRLP GSIGYVEYAY AKQNNLAYTK LISADGKVVA       240
     PTEANFSAAA KGADWSKSFA QDLTAQKGDN VWPITSTTFI LIHKQQKNAA NGIEVLKFFD       300
     WAYEQGGKQA KDLDYSVLPQ DVIGQIRAAW KRDIKDSSGN PLY                         343
//

If you have problems or comments...

PBIL Back to PBIL home page