(data stored in ACNUC1104 zone)

EMBL: FN667741.RBSA

FN667741.RBSA        Location/Qualifiers
FT   CDS             42527..44032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0009"
FT                   /gene="rbsA"
FT                   /locus_tag="XBJ1_0038"
FT                   /product="high-affinity D-ribose transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79193"
FT                   /db_xref="GOA:D3UY15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79193.1"
FT                   /translation="MEPLLELKEIDKAFPGVKALSGAALRVYPGKVMALVGENGAGKST
FT                   MMKVLTGIYTKDAGSIHYLGKNVVFSDPKSSQEAGIGIIHQELNLIPQLTIAENIFLGR
FT                   EFVNKLGIINWQKMYEEADNLLKRLNIRYSSRRLVSELSIGDQQMVEIAKVLSFQSKVI
FT                   IMDEPTDALTDTETESLFHVIRELKAQDCGIVYISHRLKEIFEICDDVTVFRDGQFIGE
FT                   QPVAALQEDTLIEMMVGRKLEDQYPRLDLPRGGKRLEIENLSGSGIKNVSFSLFGGEIL
FT                   GISGLMGAGRTELMKMIYGALPKTKGRILLDGKSLTIRNPQDGLANGIVYISEDRKRDG
FT                   LVLGMSVKENMSLTALRYFSQKPYRLNHSAEQKTVTDFIKLFNIKTPSMEQSIGLLSGG
FT                   NQQKVAIARGLMTRPKVLILVEPTRGVDVGAKKEIYQLINQFKKEGLSIILVSSEMPEV
FT                   MGMSDRILVMHEGGISGEFSADNASQEALMVAAVGKQYGAVER"
     MEPLLELKEI DKAFPGVKAL SGAALRVYPG KVMALVGENG AGKSTMMKVL TGIYTKDAGS        60
     IHYLGKNVVF SDPKSSQEAG IGIIHQELNL IPQLTIAENI FLGREFVNKL GIINWQKMYE       120
     EADNLLKRLN IRYSSRRLVS ELSIGDQQMV EIAKVLSFQS KVIIMDEPTD ALTDTETESL       180
     FHVIRELKAQ DCGIVYISHR LKEIFEICDD VTVFRDGQFI GEQPVAALQE DTLIEMMVGR       240
     KLEDQYPRLD LPRGGKRLEI ENLSGSGIKN VSFSLFGGEI LGISGLMGAG RTELMKMIYG       300
     ALPKTKGRIL LDGKSLTIRN PQDGLANGIV YISEDRKRDG LVLGMSVKEN MSLTALRYFS       360
     QKPYRLNHSA EQKTVTDFIK LFNIKTPSME QSIGLLSGGN QQKVAIARGL MTRPKVLILV       420
     EPTRGVDVGA KKEIYQLINQ FKKEGLSIIL VSSEMPEVMG MSDRILVMHE GGISGEFSAD       480
     NASQEALMVA AVGKQYGAVE R                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page