(data stored in ACNUC1104 zone)

EMBL: FN667741.RECF

FN667741.RECF        Location/Qualifiers
FT   CDS             2671..3762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0001"
FT                   /gene="recF"
FT                   /locus_tag="XBJ1_0003"
FT                   /product="gap repair protein with nucleoside triP hydrolase
FT                   domain, part of RecFOR complex that targets RecA to
FT                   ssDNA-dsDNA junction"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79158"
FT                   /db_xref="GOA:D3UXY0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79158.1"
FT                   /translation="MILSRLLIRDFRNIADADLTLATGFNFLVGPNGSGKTSILEAIYT
FT                   LGHGRAFRSIQAGRVIRHDCEEFILHGRLEQQFHERILAVGLSKNRLGDSKVRIDGSDG
FT                   HKIAELAKMLPMQLITPEGFTLLNGGPKYRRAFIDWGCFHNEPRFFTAWVNLKRLLKQR
FT                   NAALRQVTRYGQIQHWDRELAPLATEISQWRAEYIAGIAEDIEKTCKQFLPEFTLSISF
FT                   QQGWDKESEYAELLARQFERDRTLTYTASGPHKADLRIRVDGTPVEDMLSRGQLKLLMC
FT                   ALRLAQGEYFTRQSGQKCLYLLDDFASELDAGRRQLLAERLKSTQAQVFVSAITPGQVT
FT                   DMIDVNSRMFRVEHGKIEVQPQD"
     MILSRLLIRD FRNIADADLT LATGFNFLVG PNGSGKTSIL EAIYTLGHGR AFRSIQAGRV        60
     IRHDCEEFIL HGRLEQQFHE RILAVGLSKN RLGDSKVRID GSDGHKIAEL AKMLPMQLIT       120
     PEGFTLLNGG PKYRRAFIDW GCFHNEPRFF TAWVNLKRLL KQRNAALRQV TRYGQIQHWD       180
     RELAPLATEI SQWRAEYIAG IAEDIEKTCK QFLPEFTLSI SFQQGWDKES EYAELLARQF       240
     ERDRTLTYTA SGPHKADLRI RVDGTPVEDM LSRGQLKLLM CALRLAQGEY FTRQSGQKCL       300
     YLLDDFASEL DAGRRQLLAE RLKSTQAQVF VSAITPGQVT DMIDVNSRMF RVEHGKIEVQ       360
     PQD                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page