(data stored in ACNUC1104 zone)

EMBL: FN667741.RPLU

FN667741.RPLU        Location/Qualifiers
FT   CDS             361923..362231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0071"
FT                   /gene="rplU"
FT                   /locus_tag="XBJ1_0355"
FT                   /product="50S ribosomal subunit protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79505"
FT                   /db_xref="GOA:D3UYX7"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79505.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETVEFDQVLMVANGE
FT                   DIKIGAPVVEGVKVKAEVVAHGRGEKIKIVKFRRRKHSRKQQGHRQWFTDVKITGIA"
     MYAVFQSGGK QHRVSEGQTI RLEKLDIATG ETVEFDQVLM VANGEDIKIG APVVEGVKVK        60
     AEVVAHGRGE KIKIVKFRRR KHSRKQQGHR QWFTDVKITG IA                          102
//

If you have problems or comments...

PBIL Back to PBIL home page