(data stored in ACNUC1104 zone)

EMBL: FN667741.RPMA

FN667741.RPMA        Location/Qualifiers
FT   CDS             362252..362509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0071"
FT                   /gene="rpmA"
FT                   /locus_tag="XBJ1_0356"
FT                   /product="50S ribosomal subunit protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79506"
FT                   /db_xref="GOA:D3UYX8"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79506.1"
FT                   /translation="MAHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGSNVGCGRDHTLFALADGKIKFEVKGSKNRKFISIVAE"
     MAHKKAGGST RNGRDSESKR LGVKRFGGES VLAGSIIVRQ RGTKFHAGSN VGCGRDHTLF        60
     ALADGKIKFE VKGSKNRKFI SIVAE                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page