(data stored in ACNUC1104 zone)

EMBL: FN667741.RPSB

FN667741.RPSB        Location/Qualifiers
FT   CDS             606594..607319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0117"
FT                   /gene="rpsB"
FT                   /locus_tag="XBJ1_0589"
FT                   /product="30S ribosomal subunit protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79733"
FT                   /db_xref="GOA:D3UWF9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79733.1"
FT                   /translation="MATVSMRDMLQAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNSALAELNKIASRKGKILFVGTKRAACEAIKEEALGCDQYFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLEVQSQDGTFDKLTKKEALMRTRELGKLENSLGGIKDMGGLPDALFV
FT                   IDAEHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFIIPGNDDAIRAVKLYLGAVATAVR
FT                   DGRSQDLAVQAEEGLVDAE"
     MATVSMRDML QAGVHFGHQT RYWNPKMKPF IFGARNKVHI INLEKTVPMF NSALAELNKI        60
     ASRKGKILFV GTKRAACEAI KEEALGCDQY FVNHRWLGGM LTNWKTVRQS IKRLKDLEVQ       120
     SQDGTFDKLT KKEALMRTRE LGKLENSLGG IKDMGGLPDA LFVIDAEHEH IAIKEANNLG       180
     IPVFAIVDTN SDPDGVDFII PGNDDAIRAV KLYLGAVATA VRDGRSQDLA VQAEEGLVDA       240
     E                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page