(data stored in ACNUC1104 zone)

EMBL: FN667741.RPSO

FN667741.RPSO        Location/Qualifiers
FT   CDS             379080..379349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0075"
FT                   /gene="rpsO"
FT                   /locus_tag="XBJ1_0371"
FT                   /product="30S ribosomal subunit protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79521"
FT                   /db_xref="GOA:D3UYZ3"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79521.1"
FT                   /translation="MSLSTEAKAQIVAEFGRGTNDSGSSEVQVALLTAQINHLQGHFSE
FT                   HKKDHHSRRGLLRMVAQRRKLLNYLKRKDLARYTALIERLGLRR"
     MSLSTEAKAQ IVAEFGRGTN DSGSSEVQVA LLTAQINHLQ GHFSEHKKDH HSRRGLLRMV        60
     AQRRKLLNYL KRKDLARYTA LIERLGLRR                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page