(data stored in ACNUC1104 zone)

EMBL: FN667741.SIRA

FN667741.SIRA        Location/Qualifiers
FT   CDS             551986..552264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirA"
FT                   /locus_tag="XBJ1_0548"
FT                   /product="small ubiquitous RNA-binding protein required for
FT                   normal growth, cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79692"
FT                   /db_xref="GOA:D3UZB0"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79692.1"
FT                   /translation="MFEPTEIVMSNVFANPDKTLDTQGLRCPEPVMMIRKIVRHMDAGQ
FT                   TLLIIADDPATTRDIPGFCRFMEHALIAQETGQTPYRYLIKKNENVA"
     MFEPTEIVMS NVFANPDKTL DTQGLRCPEP VMMIRKIVRH MDAGQTLLII ADDPATTRDI        60
     PGFCRFMEHA LIAQETGQTP YRYLIKKNEN VA                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page