(data stored in ACNUC1104 zone)

EMBL: FN667741.TATC

FN667741.TATC        Location/Qualifiers
FT   CDS             511841..512620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0100"
FT                   /gene="tatC"
FT                   /locus_tag="XBJ1_0511"
FT                   /product="twin-arginine translocase subunit,
FT                   sec-independent protein export"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79660"
FT                   /db_xref="GOA:D3UZ78"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79660.1"
FT                   /translation="MSVDDTQPLIGHLIELRKRILNSLITVLVIFLALVYFSNDIYRLI
FT                   AAPLMEQLPKGANMIATDVASPFFTPIKLTIMVSIVVSAPMILYQVWAFIAPALYKHER
FT                   RLIMPLLFSSSVLFYLGMAFAYFVVFPIAFGFFVKTVPAGVVISTDISNYLSFVMALFM
FT                   AFGVSFEVPVAIILLCWSGVVTPESLKRKRPYILVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   YLLFEVGILLSQFYVGGRKSGRAENESEYDEGNNPEK"
     MSVDDTQPLI GHLIELRKRI LNSLITVLVI FLALVYFSND IYRLIAAPLM EQLPKGANMI        60
     ATDVASPFFT PIKLTIMVSI VVSAPMILYQ VWAFIAPALY KHERRLIMPL LFSSSVLFYL       120
     GMAFAYFVVF PIAFGFFVKT VPAGVVISTD ISNYLSFVMA LFMAFGVSFE VPVAIILLCW       180
     SGVVTPESLK RKRPYILVGA FVVGMLLTPP DVFSQTLLAI PMYLLFEVGI LLSQFYVGGR       240
     KSGRAENESE YDEGNNPEK                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page