(data stored in ACNUC1104 zone)

EMBL: FN667741.TRKH

FN667741.TRKH        Location/Qualifiers
FT   CDS             522650..524101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0103"
FT                   /gene="trkH"
FT                   /locus_tag="XBJ1_0521"
FT                   /product="potassium transport protein, requires TrkE (Trk
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79670"
FT                   /db_xref="GOA:D3UZ88"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79670.1"
FT                   /translation="MHFRAITRIVGLLVILFSVTMIIPGLVALIYRDGAGRAFSQTFIF
FT                   ALVIGLMLWVPNRNQKHDLKPKEGFLIVVLFWTVLGSVGALPFIFSEKPNLSVTDAFFE
FT                   SFSGLTTTGATTLIGLDSLPKAILFYRQMLQWLGGMGIIVLAVAILPLLGVGGMQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVLLTIACAIALWAAGMSIFDAISHSFSTIAIGG
FT                   FSTHDASIGFFNSPAINTIIAIFLLISGCNFGLHFAVLSGRSLKVYWRDPEFRMFITIQ
FT                   LALLVICVLILWQQSIYESGLDALNHAFFQVVSMATTAGFTTVSFADWPLFLPFLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLFLQGSRELKRLVHPNAVYTIKLGQRALPERIIEAVWG
FT                   FFSAYVLVFLISMLLLIATGVDEFSAFSAIAATLNNLGPGLGAVSDNFTTMNPAAKWIL
FT                   VVTMLFGRLEVFTLLVLFTPTFWRE"
     MHFRAITRIV GLLVILFSVT MIIPGLVALI YRDGAGRAFS QTFIFALVIG LMLWVPNRNQ        60
     KHDLKPKEGF LIVVLFWTVL GSVGALPFIF SEKPNLSVTD AFFESFSGLT TTGATTLIGL       120
     DSLPKAILFY RQMLQWLGGM GIIVLAVAIL PLLGVGGMQL YRAEMPGPLK DNKMRPRIAE       180
     TAKTLWLIYV LLTIACAIAL WAAGMSIFDA ISHSFSTIAI GGFSTHDASI GFFNSPAINT       240
     IIAIFLLISG CNFGLHFAVL SGRSLKVYWR DPEFRMFITI QLALLVICVL ILWQQSIYES       300
     GLDALNHAFF QVVSMATTAG FTTVSFADWP LFLPFLLLCS AFIGGCAGST GGGLKVIRIL       360
     LLFLQGSREL KRLVHPNAVY TIKLGQRALP ERIIEAVWGF FSAYVLVFLI SMLLLIATGV       420
     DEFSAFSAIA ATLNNLGPGL GAVSDNFTTM NPAAKWILVV TMLFGRLEVF TLLVLFTPTF       480
     WRE                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page