(data stored in ACNUC1104 zone)

EMBL: FN667741.TSF

FN667741.TSF         Location/Qualifiers
FT   CDS             607467..608324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0117"
FT                   /gene="tsf"
FT                   /locus_tag="XBJ1_0590"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79734"
FT                   /db_xref="GOA:D3UWG0"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79734.1"
FT                   /translation="MADITAALVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSG
FT                   QAKAAKKAGRVAAEGVILVEVAADAKYAGIVELNCETDFVAKDSGFLAFGKEVIAAVMA
FT                   DKNADIDALKAQFEEQRANLVAKIGENINIRRVTILEGDAVGSYLHGARIGVLVSAEGA
FT                   SEELIKHVAMHVAASKPEYVNPTDVPADVVAREHQIQMDIAMQSGKPREIAEKMVSGRM
FT                   NKFTGEISLTGQNFVMDPSKTVGDLMKENNAKVINFIRFEVGEGIEKVEADFAAEVAAM
FT                   SKQS"
     MADITAALVK ELRERTGAGM MECKKALVEA NGDIELAIDN MRKSGQAKAA KKAGRVAAEG        60
     VILVEVAADA KYAGIVELNC ETDFVAKDSG FLAFGKEVIA AVMADKNADI DALKAQFEEQ       120
     RANLVAKIGE NINIRRVTIL EGDAVGSYLH GARIGVLVSA EGASEELIKH VAMHVAASKP       180
     EYVNPTDVPA DVVAREHQIQ MDIAMQSGKP REIAEKMVSG RMNKFTGEIS LTGQNFVMDP       240
     SKTVGDLMKE NNAKVINFIR FEVGEGIEKV EADFAAEVAA MSKQS                       285
//

If you have problems or comments...

PBIL Back to PBIL home page