(data stored in ACNUC1104 zone)

EMBL: FN667741.TYPA

FN667741.TYPA        Location/Qualifiers
FT   CDS             222183..224006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="XBJ1_0224"
FT                   /product="GTP-binding elongation factor family protein with
FT                   P-loop containing NTP hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79375"
FT                   /db_xref="GOA:D3UYJ7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79375.1"
FT                   /translation="MSINNLRNIAIIAHVDHGKTTLVDKLLQQSGTFGERAATTERVMD
FT                   SNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLLVDAMD
FT                   GPMPQTRFVTQKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLGATDEQLDFPI
FT                   VYASALMGIAGNEHTDMAEDMTPLYQAIVDHVEPPKVDLDGPFQMQISQLDYNNYVGVI
FT                   GIGSIKRGTVKPNQTITIIDSEGKTRNGKVGKVFSHLGLDRIESAQAEAGDIIAITGLG
FT                   ELSISDTLCDTSAVEALPALAVDEPTVSMYFCVNTSPFCGREGKYVTSRQILDRLRKEL
FT                   VHNVALRVEETEDPDAFRVAGRGELHLSVLIENMRREGFEMGVSRPKVIYREIDGRKQE
FT                   PFEQVTLDIEEQHQGDVMQALGERKGEMRDMLPDGKGRVRLDYSIPSRGLIGFRTEFMT
FT                   MTSGTGLLYATFSHYDDIRPGEIGRRQNGVMISNGQGKAVAYALYSLQDRGKLFLGHGT
FT                   EVYEGQIIGIHSRSNDLTVNCLTGKKLTNVRASGTDEATTLSPYLKKTLEQALEFIDDD
FT                   ELVEVTPQSIRLRKRHLTENDRRRANRGKEM"
     MSINNLRNIA IIAHVDHGKT TLVDKLLQQS GTFGERAATT ERVMDSNDLE KERGITILAK        60
     NTAIKWNDYR INIVDTPGHA DFGGEVERVM SMVDSVLLLV DAMDGPMPQT RFVTQKAFAH       120
     GLKPIVVINK VDRPGARPDW VVDQVFDLFV NLGATDEQLD FPIVYASALM GIAGNEHTDM       180
     AEDMTPLYQA IVDHVEPPKV DLDGPFQMQI SQLDYNNYVG VIGIGSIKRG TVKPNQTITI       240
     IDSEGKTRNG KVGKVFSHLG LDRIESAQAE AGDIIAITGL GELSISDTLC DTSAVEALPA       300
     LAVDEPTVSM YFCVNTSPFC GREGKYVTSR QILDRLRKEL VHNVALRVEE TEDPDAFRVA       360
     GRGELHLSVL IENMRREGFE MGVSRPKVIY REIDGRKQEP FEQVTLDIEE QHQGDVMQAL       420
     GERKGEMRDM LPDGKGRVRL DYSIPSRGLI GFRTEFMTMT SGTGLLYATF SHYDDIRPGE       480
     IGRRQNGVMI SNGQGKAVAY ALYSLQDRGK LFLGHGTEVY EGQIIGIHSR SNDLTVNCLT       540
     GKKLTNVRAS GTDEATTLSP YLKKTLEQAL EFIDDDELVE VTPQSIRLRK RHLTENDRRR       600
     ANRGKEM                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page