(data stored in ACNUC1104 zone)

EMBL: FN667741.USPA

FN667741.USPA        Location/Qualifiers
FT   CDS             97349..97780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA"
FT                   /locus_tag="XBJ1_0090"
FT                   /product="universal stress protein A, possibly linked to
FT                   resistance to DNA-damage and respiratory uncoupling"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79241"
FT                   /db_xref="GOA:D3UY63"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79241.1"
FT                   /translation="MAYKHILVAVDLSPESQVLVEKAVSMAKPYNAKVSLIHVDVNYSD
FT                   LYTGLIDVNLGDMQQRIADETRNALKDLSVNADYEIQETLSGCGDLGQVLVDAIKQYDM
FT                   DLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEE"
     MAYKHILVAV DLSPESQVLV EKAVSMAKPY NAKVSLIHVD VNYSDLYTGL IDVNLGDMQQ        60
     RIADETRNAL KDLSVNADYE IQETLSGCGD LGQVLVDAIK QYDMDLVVCG HHQDFWSKLM       120
     SSARQLINTV HVDMLIVPLR DEE                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page