(data stored in ACNUC1104 zone)

EMBL: FN667741.YBGL

FN667741.YBGL        Location/Qualifiers
FT   CDS             532568..533335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0105"
FT                   /gene="ybgL"
FT                   /locus_tag="XBJ1_0530"
FT                   /product="putative lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79674"
FT                   /db_xref="GOA:D3UZ92"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79674.1"
FT                   /translation="MIKAIDLNSDLGESFGQWKMGNDAKMLGIVSSANVACGFHAGDPV
FT                   GILQTLKSAKENQVAIGAHISYPDLVGFGRRNMDIASHELTADVIYQIGALQGLALAAG
FT                   TSVRYVKPHGALYNTIANNERQALAVIEGILVIDPNLALVGLAGSNILRLAQEKGLKTI
FT                   AEAFADRAYTAEGELVSRREAGAVLHDVNLVAQRMLQLVTEGGVDSIDGKFTPIKADSI
FT                   CVHGDSPGALDMAKQVKKVLQQAGITIQSFIHA"
     MIKAIDLNSD LGESFGQWKM GNDAKMLGIV SSANVACGFH AGDPVGILQT LKSAKENQVA        60
     IGAHISYPDL VGFGRRNMDI ASHELTADVI YQIGALQGLA LAAGTSVRYV KPHGALYNTI       120
     ANNERQALAV IEGILVIDPN LALVGLAGSN ILRLAQEKGL KTIAEAFADR AYTAEGELVS       180
     RREAGAVLHD VNLVAQRMLQ LVTEGGVDSI DGKFTPIKAD SICVHGDSPG ALDMAKQVKK       240
     VLQQAGITIQ SFIHA                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page