(data stored in ACNUC1104 zone)

EMBL: FN667741.YECS

FN667741.YECS        Location/Qualifiers
FT   CDS             complement(439927..440679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0085"
FT                   /gene="yecS"
FT                   /locus_tag="XBJ1_0432"
FT                   /product="putative amino acid transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79582"
FT                   /db_xref="GOA:D3UZ54"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79582.1"
FT                   /translation="MLYKYVYPPYKQEEYMTPSWLSLALDSLWPMLYAGLTFTIPLTLI
FT                   TFALGISLGFIVALIRLYGSKPLVAVVRFYVWLIRGTPLLVQLFLIFYALPSVGITLEA
FT                   FTSAVIGFTLNVGAYTSEVIRAALISVPKGQWEASHSIGMSWWQSLRRIVLPQAARVSI
FT                   PPLSNTFISLVKDTSLASVITVPEMFLAAQRIAAVTYQPLILYTEAAILYLLLSSVLSA
FT                   LQVRLEKKFSQQFSQHRSSKEAKNDSAL"
     MLYKYVYPPY KQEEYMTPSW LSLALDSLWP MLYAGLTFTI PLTLITFALG ISLGFIVALI        60
     RLYGSKPLVA VVRFYVWLIR GTPLLVQLFL IFYALPSVGI TLEAFTSAVI GFTLNVGAYT       120
     SEVIRAALIS VPKGQWEASH SIGMSWWQSL RRIVLPQAAR VSIPPLSNTF ISLVKDTSLA       180
     SVITVPEMFL AAQRIAAVTY QPLILYTEAA ILYLLLSSVL SALQVRLEKK FSQQFSQHRS       240
     SKEAKNDSAL                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page