(data stored in ACNUC1104 zone)

EMBL: FN667741.YEHU

FN667741.YEHU        Location/Qualifiers
FT   CDS             complement(385732..387429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0076"
FT                   /gene="yehU"
FT                   /locus_tag="XBJ1_0376"
FT                   /product="putative sensory kinase in two-component
FT                   regulatory system"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79526"
FT                   /db_xref="GOA:D3UYZ8"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79526.1"
FT                   /translation="MHEFNLVLLLLQQMCVYLVIAWLLSKTPLFIPLLQVSVRLPHKLM
FT                   CYVIFSIFCIMGTYFGLSVNDSIANTRAIGAVLGGFLGGPAVGAMVGFTGGLHRYSLGG
FT                   MTAFSCMVSTIVEGILGGLVHSYLMKRGQINKLLNPWTAAIVTFLAECIQMSIILLLAN
FT                   PFSDALKLVKNIAAPMIIANSIGAAMFIRILLDRRAIFEKYTSAFSAQALKIAVCTEGI
FT                   LRKGFNEDNSMRVAKVIYQELEIGAVAITDRDKLLAFIGIGSDHHLSGTPIVSEQSHRA
FT                   IENNEVVYADGNETPYRCSLSPICKLGSALVIPLRGENQQVIGTIKLYEAKNCLFSSIN
FT                   RTLGEGIASLLSAQILAGQYERNKQSLLQSEVKLLHAQVNPHFLFNALNTLQAVIRRDS
FT                   QQAGQLVQYLSTFFRKNLKRPEEIATLENEIEHVNAYLQIEKARFRERLQIAIAIPESL
FT                   RCAKLPAFSLQPMVENAIKHGTSQLLDTGRVTIRAHQKANLLLVEIEDNAGLYCLKKIG
FT                   DGLGMSLVDKRLRLRYGERYGMRVDCQPEKFTRVILCLPLEKETDKAV"
     MHEFNLVLLL LQQMCVYLVI AWLLSKTPLF IPLLQVSVRL PHKLMCYVIF SIFCIMGTYF        60
     GLSVNDSIAN TRAIGAVLGG FLGGPAVGAM VGFTGGLHRY SLGGMTAFSC MVSTIVEGIL       120
     GGLVHSYLMK RGQINKLLNP WTAAIVTFLA ECIQMSIILL LANPFSDALK LVKNIAAPMI       180
     IANSIGAAMF IRILLDRRAI FEKYTSAFSA QALKIAVCTE GILRKGFNED NSMRVAKVIY       240
     QELEIGAVAI TDRDKLLAFI GIGSDHHLSG TPIVSEQSHR AIENNEVVYA DGNETPYRCS       300
     LSPICKLGSA LVIPLRGENQ QVIGTIKLYE AKNCLFSSIN RTLGEGIASL LSAQILAGQY       360
     ERNKQSLLQS EVKLLHAQVN PHFLFNALNT LQAVIRRDSQ QAGQLVQYLS TFFRKNLKRP       420
     EEIATLENEI EHVNAYLQIE KARFRERLQI AIAIPESLRC AKLPAFSLQP MVENAIKHGT       480
     SQLLDTGRVT IRAHQKANLL LVEIEDNAGL YCLKKIGDGL GMSLVDKRLR LRYGERYGMR       540
     VDCQPEKFTR VILCLPLEKE TDKAV                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page