(data stored in ACNUC1104 zone)

EMBL: FN667741.YEIC

FN667741.YEIC        Location/Qualifiers
FT   CDS             434703..435776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeiC"
FT                   /locus_tag="XBJ1_0426"
FT                   /product="putative sugar kinase with ribokinase-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79576"
FT                   /db_xref="GOA:D3UZ48"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79576.1"
FT                   /translation="MPSRENQILRLIKQDPFIQQQEIADILGVSRSCVAGHIMNMNKKG
FT                   HIKGKGYIFPSPNNAYAVTIGAANMDFTSYASEKLVYEDSNPGKIISTPGGVGRNIAQN
FT                   IAALKSESHFISVVGNDYNGKVLFEQTKLAGVNIRYFHKLDEEKTSICNSIIDENGKCI
FT                   VSVNDMDIMEKLTPTLLSQSEELIRRASVLVIDCNLTEGALEWLFNHAGNVPIFIDTVS
FT                   TFKATKIRHWLSYIHTLKPNRSEAEILSGIEIETQKDAAIAASWFHQQGVQRLILSMGA
FT                   EGVYYSELDNKSGYSRAITTSVLNASGAGDAMMAGLAHCWLQSMSLEDSIRYAQRCSAL
FT                   TLSSEDTWILPNKSSIP"
     MPSRENQILR LIKQDPFIQQ QEIADILGVS RSCVAGHIMN MNKKGHIKGK GYIFPSPNNA        60
     YAVTIGAANM DFTSYASEKL VYEDSNPGKI ISTPGGVGRN IAQNIAALKS ESHFISVVGN       120
     DYNGKVLFEQ TKLAGVNIRY FHKLDEEKTS ICNSIIDENG KCIVSVNDMD IMEKLTPTLL       180
     SQSEELIRRA SVLVIDCNLT EGALEWLFNH AGNVPIFIDT VSTFKATKIR HWLSYIHTLK       240
     PNRSEAEILS GIEIETQKDA AIAASWFHQQ GVQRLILSMG AEGVYYSELD NKSGYSRAIT       300
     TSVLNASGAG DAMMAGLAHC WLQSMSLEDS IRYAQRCSAL TLSSEDTWIL PNKSSIP          357
//

If you have problems or comments...

PBIL Back to PBIL home page