(data stored in ACNUC1104 zone)

EMBL: FN667741.YGDE

FN667741.YGDE        Location/Qualifiers
FT   CDS             complement(493006..494103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0096"
FT                   /gene="ygdE"
FT                   /locus_tag="XBJ1_0492"
FT                   /product="putative RNA 2'-O-ribose methyltransferase,
FT                   SAM-dependent domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79641"
FT                   /db_xref="GOA:D3UWD2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR011224"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040739"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79641.1"
FT                   /translation="MNKVALYCRPGFEKECAAEITDKAGKKGIYGFARVKENSGYVLFE
FT                   CYQHDDADRLIREIPFGELIFARQMVVVGELLKNLPQEDRITPILGMLTGVIERAGELR
FT                   VEVPDNDESKELMTFCRKFTVPLRHAMRQEKFLLAKESANRPVIHVLFIAPGCCYVGYS
FT                   YSNNNSRFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPHDEWEERLGSGLYAVDLGACP
FT                   GGWTYQLVKRGMIVHAVDNGLMADSLMDTGQVKHHRVDGFKFEPTVKNVYWLVCDMVEQ
FT                   PAKVAHLMTDWLVKSWCREAIFNLKLPMKKRYEEVAQILQKIEQQLKENGVNAQIQAKH
FT                   LYHDREEVTVHVRRIWSAYAMTRDF"
     MNKVALYCRP GFEKECAAEI TDKAGKKGIY GFARVKENSG YVLFECYQHD DADRLIREIP        60
     FGELIFARQM VVVGELLKNL PQEDRITPIL GMLTGVIERA GELRVEVPDN DESKELMTFC       120
     RKFTVPLRHA MRQEKFLLAK ESANRPVIHV LFIAPGCCYV GYSYSNNNSR FYMGIPRLKF       180
     PSDAPSRSTL KLEEAFHVFI PHDEWEERLG SGLYAVDLGA CPGGWTYQLV KRGMIVHAVD       240
     NGLMADSLMD TGQVKHHRVD GFKFEPTVKN VYWLVCDMVE QPAKVAHLMT DWLVKSWCRE       300
     AIFNLKLPMK KRYEEVAQIL QKIEQQLKEN GVNAQIQAKH LYHDREEVTV HVRRIWSAYA       360
     MTRDF                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page