(data stored in ACNUC1104 zone)

EMBL: FN667741.YHAI

FN667741.YHAI        Location/Qualifiers
FT   CDS             90438..90836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /gene="yhaI"
FT                   /locus_tag="XBJ1_0084"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79235"
FT                   /db_xref="GOA:D3UY57"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79235.1"
FT                   /translation="MHWYLNVLNNYACFRGRAQRKTFWYFVLFQILAVLIISFLERLFA
FT                   VANPEIYMGWFSAIYLLLTFLPALAVNARRLHDINCSAWWLLLHLIPFVGTVILLILAA
FT                   LKGQAGSNKYSSESRVHSQGNTQSQANG"
     MHWYLNVLNN YACFRGRAQR KTFWYFVLFQ ILAVLIISFL ERLFAVANPE IYMGWFSAIY        60
     LLLTFLPALA VNARRLHDIN CSAWWLLLHL IPFVGTVILL ILAALKGQAG SNKYSSESRV       120
     HSQGNTQSQA NG                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page