(data stored in ACNUC1104 zone)

EMBL: FN667741.YHBT

FN667741.YHBT        Location/Qualifiers
FT   CDS             400069..400449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0078"
FT                   /gene="yhbT"
FT                   /locus_tag="XBJ1_0387"
FT                   /product="putative sterol carrier protein, SCP"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79537"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79537.1"
FT                   /translation="MLGKIHSHLVSQEPTLLRLSLKVTPFALPHQVLEQLLGWQFHGVL
FT                   AEGELAFLESRREDPDTLFFQHRLRIEGNTELGLHVKNLVDAIRLGSMPSILRLGLLCL
FT                   AEFIKAGQKEGVDQHDRALSSC"
     MLGKIHSHLV SQEPTLLRLS LKVTPFALPH QVLEQLLGWQ FHGVLAEGEL AFLESRREDP        60
     DTLFFQHRLR IEGNTELGLH VKNLVDAIRL GSMPSILRLG LLCLAEFIKA GQKEGVDQHD       120
     RALSSC                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page