(data stored in ACNUC1104 zone)

EMBL: FN667741.YHBY

FN667741.YHBY        Location/Qualifiers
FT   CDS             complement(366231..366524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbY"
FT                   /locus_tag="XBJ1_0360"
FT                   /product="putative RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79510"
FT                   /db_xref="GOA:D3UYY2"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79510.1"
FT                   /translation="MTLNKKQVQYLKSLAHSLKPVVMIGNNGLTEGVLAEIEQTLSHHE
FT                   LIKVKVAGEDREIKTLIAEAIVRETGAYNVQIIGKMLVLYRPSKERRISLPK"
     MTLNKKQVQY LKSLAHSLKP VVMIGNNGLT EGVLAEIEQT LSHHELIKVK VAGEDREIKT        60
     LIAEAIVRET GAYNVQIIGK MLVLYRPSKE RRISLPK                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page