(data stored in ACNUC1104 zone)

EMBL: FN667741.YHFS

FN667741.YHFS        Location/Qualifiers
FT   CDS             complement(132966..134060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0026"
FT                   /gene="yhfS"
FT                   /locus_tag="XBJ1_0130"
FT                   /product="putative enzyme with PLP-dependent tansferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79281"
FT                   /db_xref="GOA:D3UYA3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79281.1"
FT                   /translation="MKTYPLQSMTMAQAQQQQFKLVDIICRHFPGADFLSQGDLGLVPD
FT                   LHQPRMTHRIEAVIAEHFGAEAAAFVNGAGTGALRAGLAALVSPNATLLVHDAPIYPTT
FT                   KISIEQMGLHVVYADFNHTEQIAAAIRQYQPAASLIQHTRQKIDDSYALQDVLAILHQY
FT                   QIPSLVDDNYAAMKVAHIGCEYGATLSSFSCFKLLGPQGVGLVIGKQTMIETLRRSMYS
FT                   GGCQIQGYQAMEALRGLVSAPVIHAVQAEVNETLVTRLNQGELPQVKQAFLANAQSKVL
FT                   LVEFHDPIAEAVLTAAHGLGALPYPVGAESKFEIPPLFYRISGTFRQADPTLEKRMIRI
FT                   NPNRSGAETVMRILRESIFQKSGQ"
     MKTYPLQSMT MAQAQQQQFK LVDIICRHFP GADFLSQGDL GLVPDLHQPR MTHRIEAVIA        60
     EHFGAEAAAF VNGAGTGALR AGLAALVSPN ATLLVHDAPI YPTTKISIEQ MGLHVVYADF       120
     NHTEQIAAAI RQYQPAASLI QHTRQKIDDS YALQDVLAIL HQYQIPSLVD DNYAAMKVAH       180
     IGCEYGATLS SFSCFKLLGP QGVGLVIGKQ TMIETLRRSM YSGGCQIQGY QAMEALRGLV       240
     SAPVIHAVQA EVNETLVTRL NQGELPQVKQ AFLANAQSKV LLVEFHDPIA EAVLTAAHGL       300
     GALPYPVGAE SKFEIPPLFY RISGTFRQAD PTLEKRMIRI NPNRSGAETV MRILRESIFQ       360
     KSGQ                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page