(data stored in ACNUC1104 zone)

EMBL: FN667741.YHFT

FN667741.YHFT        Location/Qualifiers
FT   CDS             complement(134065..135432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0026"
FT                   /gene="yhfT"
FT                   /locus_tag="XBJ1_0131"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79282"
FT                   /db_xref="GOA:D3UYA4"
FT                   /db_xref="InterPro:IPR019733"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79282.1"
FT                   /translation="MSDINAIQHLHSFLMSLMEVDPFKAGLLAAIGAIAAMMANRGIAV
FT                   FHDGLRPLLPEYLEGRMSRKALAATSFALSIGLVVGFGIPFSLAAPIVLVHSLLLGTDM
FT                   IGIWCANSRRGFIASGIIGALYAIALLAGLRSVVELFAMLPVNFTDDLKKVGDPIVACF
FT                   ALFPAIVVGYQYGYRKGLWVMLTALIGYLATKAVGPLSFGGMIEKPVSFDPNGAALLLS
FT                   MIAMFYFAMRERPAQSAEQKGANEVLVGLFSTRIERIQKNKWLLILCGGLTASAATMSF
FT                   SLLAEGPVSLQLMAQGEQTNALLVALARAISFIPLVGTTAIATGVYSPNGMKFVFVAGL
FT                   ATNNPWIAFIAGGITMFIEIQLLAKIAIWLDKYPGVKACSGHIRTAITKMLEVALLVGG
FT                   MIASNAILPGIGFMIVAGIYLLNRTSRRPLVEMAIGPIATIAVGILANVLYLLGIK"
     MSDINAIQHL HSFLMSLMEV DPFKAGLLAA IGAIAAMMAN RGIAVFHDGL RPLLPEYLEG        60
     RMSRKALAAT SFALSIGLVV GFGIPFSLAA PIVLVHSLLL GTDMIGIWCA NSRRGFIASG       120
     IIGALYAIAL LAGLRSVVEL FAMLPVNFTD DLKKVGDPIV ACFALFPAIV VGYQYGYRKG       180
     LWVMLTALIG YLATKAVGPL SFGGMIEKPV SFDPNGAALL LSMIAMFYFA MRERPAQSAE       240
     QKGANEVLVG LFSTRIERIQ KNKWLLILCG GLTASAATMS FSLLAEGPVS LQLMAQGEQT       300
     NALLVALARA ISFIPLVGTT AIATGVYSPN GMKFVFVAGL ATNNPWIAFI AGGITMFIEI       360
     QLLAKIAIWL DKYPGVKACS GHIRTAITKM LEVALLVGGM IASNAILPGI GFMIVAGIYL       420
     LNRTSRRPLV EMAIGPIATI AVGILANVLY LLGIK                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page