(data stored in ACNUC1104 zone)

EMBL: FN667741.YHHF

FN667741.YHHF        Location/Qualifiers
FT   CDS             complement(555299..555898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0108"
FT                   /gene="yhhF"
FT                   /locus_tag="XBJ1_0551"
FT                   /product="putative methyltransferase with SAM-dependent
FT                   methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79695"
FT                   /db_xref="GOA:D3UZB3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79695.1"
FT                   /translation="MTKKSQSASLGQIRIIGGKWRGRKLPVPDSEGLRPTTDRVRETLF
FT                   NWLMPIIQEARCLDCFSGSGALGIEALSRNASHATLLEYDRHVAKQLSANLALLKAENA
FT                   NVVQGNTLQYLNQTGTPFDVVFLDPPFRKGMLVETINLLEANGWLAEESWIYVEAESES
FT                   TATEAPANWQLHREKIAGQVAYRLYIRRQQSGDRSA"
     MTKKSQSASL GQIRIIGGKW RGRKLPVPDS EGLRPTTDRV RETLFNWLMP IIQEARCLDC        60
     FSGSGALGIE ALSRNASHAT LLEYDRHVAK QLSANLALLK AENANVVQGN TLQYLNQTGT       120
     PFDVVFLDPP FRKGMLVETI NLLEANGWLA EESWIYVEAE SESTATEAPA NWQLHREKIA       180
     GQVAYRLYIR RQQSGDRSA                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page