(data stored in ACNUC1104 zone)

EMBL: FN667741.YHIN

FN667741.YHIN        Location/Qualifiers
FT   CDS             complement(94089..95282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhiN"
FT                   /locus_tag="XBJ1_0088"
FT                   /product="putative oxidoreductase with FAD/NAD(P)-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79239"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79239.1"
FT                   /translation="MEKFDVVIIGAGAAGLFCAAQAGQEGLNVLVLDNGKKAGRKILMS
FT                   GGGRCNFTNMYTEPAAYLSANPHFCKSALARYTQWDFIDLVQQHGIAYHEKALGQLFCD
FT                   DSAQQIIDLLLKECEAGQVTVRLRSEVTQIEKDEQGFVITTAGKKVSAHSLVVASGGLS
FT                   MPGLGASPLGYRIAEQFGLNILPTHAALVPFTLHKPLLEQLQTLSGVAVPSIVTAKDGT
FT                   VFRENILFTHRGLSGPAILQISSYWQPGEYVSINLLPDMDLDAFLDKERESHPNQNLKN
FT                   TLAKLLPKRLVECLQSLEQLPDVSLKQINPAQQKELIATLQYWQVQPNGTEGYRTAEVT
FT                   MGGIDTNELSSKTMESHKVKGLYFIGEVVDVTGWLGGYNFQWAWSSAWACAQALVVV"
     MEKFDVVIIG AGAAGLFCAA QAGQEGLNVL VLDNGKKAGR KILMSGGGRC NFTNMYTEPA        60
     AYLSANPHFC KSALARYTQW DFIDLVQQHG IAYHEKALGQ LFCDDSAQQI IDLLLKECEA       120
     GQVTVRLRSE VTQIEKDEQG FVITTAGKKV SAHSLVVASG GLSMPGLGAS PLGYRIAEQF       180
     GLNILPTHAA LVPFTLHKPL LEQLQTLSGV AVPSIVTAKD GTVFRENILF THRGLSGPAI       240
     LQISSYWQPG EYVSINLLPD MDLDAFLDKE RESHPNQNLK NTLAKLLPKR LVECLQSLEQ       300
     LPDVSLKQIN PAQQKELIAT LQYWQVQPNG TEGYRTAEVT MGGIDTNELS SKTMESHKVK       360
     GLYFIGEVVD VTGWLGGYNF QWAWSSAWAC AQALVVV                                397
//

If you have problems or comments...

PBIL Back to PBIL home page