(data stored in ACNUC1104 zone)

EMBL: FN667741.YHIQ

FN667741.YHIQ        Location/Qualifiers
FT   CDS             complement(99469..100212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0017"
FT                   /gene="yhiQ"
FT                   /locus_tag="XBJ1_0092"
FT                   /product="putative methyltransferase with SAM-dependent
FT                   methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79243"
FT                   /db_xref="GOA:D3UY65"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79243.1"
FT                   /translation="MKICLICEQGADSSALSQLAERWNLVHDEDSVMALVLTPERLELR
FT                   KLDEPKLGGIYVDFVAGTMAHRRRFGGGRGEAVAKAVGIKKGYLPTVVDATAGLGRDAF
FT                   VLASIGCQVRMLERHPVVAALLDDGLQRGYQNEEIGSWLKERMTLIHTSSITALTDITP
FT                   PPDVVYLDPMYPHRQKSALVKKEMRVFQSLVGADEDADGLLEPARALAKRRVVVKRPDY
FT                   AEPLAGAKASAAITTKNHRFDIYPC"
     MKICLICEQG ADSSALSQLA ERWNLVHDED SVMALVLTPE RLELRKLDEP KLGGIYVDFV        60
     AGTMAHRRRF GGGRGEAVAK AVGIKKGYLP TVVDATAGLG RDAFVLASIG CQVRMLERHP       120
     VVAALLDDGL QRGYQNEEIG SWLKERMTLI HTSSITALTD ITPPPDVVYL DPMYPHRQKS       180
     ALVKKEMRVF QSLVGADEDA DGLLEPARAL AKRRVVVKRP DYAEPLAGAK ASAAITTKNH       240
     RFDIYPC                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page