(data stored in ACNUC1104 zone)

EMBL: FN667741.YIEG

FN667741.YIEG        Location/Qualifiers
FT   CDS             197643..198980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yieG"
FT                   /locus_tag="XBJ1_0205"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79356"
FT                   /db_xref="GOA:D3UYH8"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79356.1"
FT                   /translation="MSTLNSGPANQQGLLQRVFKLEEHGTTVRTEMIAGFTTFLTMVYI
FT                   VFVNPQILAVAGMDIKAVFVTTCLIAAFGSIMMGLMANLPVAVAPAMGLNAFFAFVVVG
FT                   AMGISWQVAMGAIFWGAVGLLILTIFRVRYWMIANIPLSLRIGITSGIGLFIAMMGLKN
FT                   AGIIVPNPDTIVSIGNFASHNVLLGTLGFFIIAILAARNFHAAVLVSIVVTTVIGLMMG
FT                   YVEYHGIFDLPPSVMSVVGNVDVKGALDIALSGVIFSFMLVNLFDSSGTLIGVTDKAGI
FT                   ADSSGKFPRMKQALYVDSISSVAGSYVGTSSVTAYIESSSGVSVGGRTGLTAIVVGMLF
FT                   LLVMFASPLASMVPAYATAGALVYVGVLMTSSLTRVKWNDLTESVPAFITAVMMPFSFS
FT                   ITEGIALGFIAYCAMKLGTGKWREISPCVIVVTLLFVLKMAFVDAH"
     MSTLNSGPAN QQGLLQRVFK LEEHGTTVRT EMIAGFTTFL TMVYIVFVNP QILAVAGMDI        60
     KAVFVTTCLI AAFGSIMMGL MANLPVAVAP AMGLNAFFAF VVVGAMGISW QVAMGAIFWG       120
     AVGLLILTIF RVRYWMIANI PLSLRIGITS GIGLFIAMMG LKNAGIIVPN PDTIVSIGNF       180
     ASHNVLLGTL GFFIIAILAA RNFHAAVLVS IVVTTVIGLM MGYVEYHGIF DLPPSVMSVV       240
     GNVDVKGALD IALSGVIFSF MLVNLFDSSG TLIGVTDKAG IADSSGKFPR MKQALYVDSI       300
     SSVAGSYVGT SSVTAYIESS SGVSVGGRTG LTAIVVGMLF LLVMFASPLA SMVPAYATAG       360
     ALVYVGVLMT SSLTRVKWND LTESVPAFIT AVMMPFSFSI TEGIALGFIA YCAMKLGTGK       420
     WREISPCVIV VTLLFVLKMA FVDAH                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page