(data stored in ACNUC1104 zone)

EMBL: FN667741.YIGM

FN667741.YIGM        Location/Qualifiers
FT   CDS             499516..500415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0097"
FT                   /gene="yigM"
FT                   /locus_tag="XBJ1_0497"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79646"
FT                   /db_xref="GOA:D3UZ64"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79646.1"
FT                   /translation="MWLLTITTFLWAASFSLIGAYLAGQVDSWFSVFIRVVLAALVFLP
FT                   FLRWRGLSLKVISLYMVVGACQLGVMYLFVFHAYHYLTVAEFLLFTVMTPLYVTLIYDV
FT                   MGRQRLRWGYAMSSLLAVAGAAIIRYDRLSESFWIGLILVQLANIFFAIGQVGYKRLME
FT                   VYPIPQRVAFSWFYLGACVVATIGWLLFGDPYKLPTTQLQWGVLIWLGAGASGIGYFMW
FT                   NYGATQVDTGTLAIMNNMLVPAGLLVNFLIWQQHPDWLGFTIGSSLIVASLWVHHRWIL
FT                   KPVLQTANCPPRAGAQNE"
     MWLLTITTFL WAASFSLIGA YLAGQVDSWF SVFIRVVLAA LVFLPFLRWR GLSLKVISLY        60
     MVVGACQLGV MYLFVFHAYH YLTVAEFLLF TVMTPLYVTL IYDVMGRQRL RWGYAMSSLL       120
     AVAGAAIIRY DRLSESFWIG LILVQLANIF FAIGQVGYKR LMEVYPIPQR VAFSWFYLGA       180
     CVVATIGWLL FGDPYKLPTT QLQWGVLIWL GAGASGIGYF MWNYGATQVD TGTLAIMNNM       240
     LVPAGLLVNF LIWQQHPDWL GFTIGSSLIV ASLWVHHRWI LKPVLQTANC PPRAGAQNE        299
//

If you have problems or comments...

PBIL Back to PBIL home page