(data stored in ACNUC1104 zone)

EMBL: FN667741.YIHX

FN667741.YIHX        Location/Qualifiers
FT   CDS             224222..224881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0047"
FT                   /gene="yihX"
FT                   /locus_tag="XBJ1_0225"
FT                   /product="putative enzyme with a phosphatase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79376"
FT                   /db_xref="GOA:D3UYJ8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79376.1"
FT                   /translation="MIKVQNDNRQSGGIMLYIFDMGNVIIDIDFKRVLAVWSNLSGTPL
FT                   ATLTTRFSMGEAFEQHECGQITDTAFAEALCDEMEVSLSFEQFTEGWHALFIDVRQDVI
FT                   ELMNKLREQGHRVVVLSNTNRLHFDYWPHHYPEIAASTDFLYLSQDLGMRKPNSDIFKY
FT                   VLGAEGVTAVQAVFFDDVLVNVEAARKIGINAIHVTDRSVIPDYFKAHDFSLPSET"
     MIKVQNDNRQ SGGIMLYIFD MGNVIIDIDF KRVLAVWSNL SGTPLATLTT RFSMGEAFEQ        60
     HECGQITDTA FAEALCDEME VSLSFEQFTE GWHALFIDVR QDVIELMNKL REQGHRVVVL       120
     SNTNRLHFDY WPHHYPEIAA STDFLYLSQD LGMRKPNSDI FKYVLGAEGV TAVQAVFFDD       180
     VLVNVEAARK IGINAIHVTD RSVIPDYFKA HDFSLPSET                              219
//

If you have problems or comments...

PBIL Back to PBIL home page