(data stored in ACNUC1104 zone)

EMBL: FN667741.YJCD

FN667741.YJCD        Location/Qualifiers
FT   CDS             496254..497600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjcD"
FT                   /locus_tag="XBJ1_0495"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79644"
FT                   /db_xref="GOA:D3UZ62"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79644.1"
FT                   /translation="MSGMQAPTQCKLDKYFKITERGTTVRQEILAGLTTFLAMVYSVIV
FT                   VPGMLGQAGFPHTAVFISVCLVTGIGSLLMGLWVNLPMAIGCAISLTAFTAFSLVLGQQ
FT                   VSIPVALGAVFLMGCLFTVISVTGIRSWILRNMPMGIAHGTGIGIGLFLLLIAANGVGM
FT                   VIKNPHAGLPVAFGSLTAFPVIMTLLGLAGIIGLERKKVPGGILLVIIVISIIGLIFDP
FT                   AVKYQGFFKLPTLGEDGLSLMFSMDIVGALQPVVLPSVLALVMTAIFDATGTIRAVAGQ
FT                   ANLLDKGGQIINGGKALTADSVSSIFAGAMGSSPAAVYIESAAGTAAGGKTGLTAAVVG
FT                   ILFLLILFLSPLSYLVPAYATAPALMYVGLLMLSNVRKLNFDDSVEAMSGLLCAVFIVL
FT                   TCNIVTGIMLGFSALVVGRVFSGEWRKLNIGTVIIAIVLVIFYAGNWAI"
     MSGMQAPTQC KLDKYFKITE RGTTVRQEIL AGLTTFLAMV YSVIVVPGML GQAGFPHTAV        60
     FISVCLVTGI GSLLMGLWVN LPMAIGCAIS LTAFTAFSLV LGQQVSIPVA LGAVFLMGCL       120
     FTVISVTGIR SWILRNMPMG IAHGTGIGIG LFLLLIAANG VGMVIKNPHA GLPVAFGSLT       180
     AFPVIMTLLG LAGIIGLERK KVPGGILLVI IVISIIGLIF DPAVKYQGFF KLPTLGEDGL       240
     SLMFSMDIVG ALQPVVLPSV LALVMTAIFD ATGTIRAVAG QANLLDKGGQ IINGGKALTA       300
     DSVSSIFAGA MGSSPAAVYI ESAAGTAAGG KTGLTAAVVG ILFLLILFLS PLSYLVPAYA       360
     TAPALMYVGL LMLSNVRKLN FDDSVEAMSG LLCAVFIVLT CNIVTGIMLG FSALVVGRVF       420
     SGEWRKLNIG TVIIAIVLVI FYAGNWAI                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page