(data stored in ACNUC1104 zone)

EMBL: FN667741.YJGP

FN667741.YJGP        Location/Qualifiers
FT   CDS             451085..452185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0089"
FT                   /gene="yjgP"
FT                   /locus_tag="XBJ1_0448"
FT                   /product="putative transmembrane protein, transport"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79598"
FT                   /db_xref="GOA:D3UW89"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79598.1"
FT                   /translation="MIIIRYLVRETLKSQIAILFILLLIFFSQKLVEVLGAAVEGSVPA
FT                   NLVLSLLGLGVPEMAQLILPLSLFLGVLMTFSKLYTESEITVMHACGLGKGVLVKSALI
FT                   LALFTSMLAAANVLWFTPWSSKYQEQVLADAKANPSLAAIMEGQFKPSRDGNMVLYIGD
FT                   VKGNNFENVFLAQLRPVNNQRPSVVIADGGHMEERPNGNQVAVLHQGVRYEGTALMRDF
FT                   RITDFKNYQAVIGHKAADIDSDKVEQKTFSQLWHKGDEDSRAELHWRLTLIVSVLVMAL
FT                   LVVPLSAVNPRQGRVLSMLPAMLLYLIFFLLQSSLRSNGGRGKLDPAFWMWLVNGAYFA
FT                   LALALNMWDTVPMRKLRSRFKNQGAA"
     MIIIRYLVRE TLKSQIAILF ILLLIFFSQK LVEVLGAAVE GSVPANLVLS LLGLGVPEMA        60
     QLILPLSLFL GVLMTFSKLY TESEITVMHA CGLGKGVLVK SALILALFTS MLAAANVLWF       120
     TPWSSKYQEQ VLADAKANPS LAAIMEGQFK PSRDGNMVLY IGDVKGNNFE NVFLAQLRPV       180
     NNQRPSVVIA DGGHMEERPN GNQVAVLHQG VRYEGTALMR DFRITDFKNY QAVIGHKAAD       240
     IDSDKVEQKT FSQLWHKGDE DSRAELHWRL TLIVSVLVMA LLVVPLSAVN PRQGRVLSML       300
     PAMLLYLIFF LLQSSLRSNG GRGKLDPAFW MWLVNGAYFA LALALNMWDT VPMRKLRSRF       360
     KNQGAA                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page