(data stored in ACNUC1104 zone)

EMBL: FN667741.YJGQ

FN667741.YJGQ        Location/Qualifiers
FT   CDS             452185..453261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0089"
FT                   /gene="yjgQ"
FT                   /locus_tag="XBJ1_0449"
FT                   /product="putative transmembrane protein, transport"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79599"
FT                   /db_xref="GOA:D3UW90"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79599.1"
FT                   /translation="MFGVLDRYIGRTILQTILMTLFTLVSLSGIIKFVDQLRKVGQGEY
FT                   SAFAAGIYTLLSVPKDIQIFFPMAALLGGLLGLGALATRSELVVMQASGFTRLQVAGSV
FT                   MKTAIPLVFLTMVIGEWVAPQGEQIARNYRSQKMFGGSLMSTAKGMWAKDGNDFVYIKS
FT                   VDKDNALRDVSIYHFDDNKKLLSVKYAATAVYDQNNRQWKLSQVEESDLRQIGRITGSQ
FT                   RISAEWKSLLTPEKLGVVALDPDALSIRGLQQYITYLKQGQQDAGRYQLNMWKKVFAPL
FT                   SVAVMMLMALSFIFGPLRSVAMGVRVIAGISTGFIFYVLNEIFGPLSLVYSMPPLLGAL
FT                   LPSLLFFVVSVYFLLHRK"
     MFGVLDRYIG RTILQTILMT LFTLVSLSGI IKFVDQLRKV GQGEYSAFAA GIYTLLSVPK        60
     DIQIFFPMAA LLGGLLGLGA LATRSELVVM QASGFTRLQV AGSVMKTAIP LVFLTMVIGE       120
     WVAPQGEQIA RNYRSQKMFG GSLMSTAKGM WAKDGNDFVY IKSVDKDNAL RDVSIYHFDD       180
     NKKLLSVKYA ATAVYDQNNR QWKLSQVEES DLRQIGRITG SQRISAEWKS LLTPEKLGVV       240
     ALDPDALSIR GLQQYITYLK QGQQDAGRYQ LNMWKKVFAP LSVAVMMLMA LSFIFGPLRS       300
     VAMGVRVIAG ISTGFIFYVL NEIFGPLSLV YSMPPLLGAL LPSLLFFVVS VYFLLHRK         358
//

If you have problems or comments...

PBIL Back to PBIL home page