(data stored in ACNUC1104 zone)

EMBL: FN667741.YRFF

FN667741.YRFF        Location/Qualifiers
FT   CDS             75246..77303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0014"
FT                   /gene="yrfF"
FT                   /locus_tag="XBJ1_0068"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79219"
FT                   /db_xref="GOA:D3UY41"
FT                   /db_xref="InterPro:IPR010771"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79219.1"
FT                   /translation="MVSFLTFRWKRPDNARYLPSIAKTGHRKLNADEYQAIDSYLQNAL
FT                   SLMQPDRSHRSGQPALSVKNDTVYTINHTINRFSVATDESQYWRYYVDEMEIHLPALLE
FT                   SFIKQQNTIEIVQTTFMPLVIAVNGHFLKDYQQDLSIARIVKQTAQASIQKNGNSIANF
FT                   LYIRKETPEENRLRRSTGILEGILMCIGLSLWFLALFMPTPILPWLMLAAVLFLITSFW
FT                   LTFRSPSPRNILNISCFNGIPKRWGIFSESEPEQRRNISLGGIDLIYPSHWEPYVVREL
FT                   DQNTDVDIYTNCHVVQQGRYLSLHEEEKHYPYQRYRKNLILVVFSICAMLVLYFYQPVS
FT                   LSMRLSFAWLYGSNTQVITSVTELQNMPLKEGDVLRVKGIGMCYIPPRLNDNPGGIKHI
FT                   FTAFDCTGIYWNNDSPLPIPESDIIENASTLITTVNEQLHPIERSRKTNSDLNEAIAKS
FT                   GMTLLDNFSQVILKTHNLCMDEIDCIRLKSALVNLSNAEDWNDLLKQAERGKLNGTKVL
FT                   LRSVSADALEKLIDTTTASFIYREIDKISILLNSPSPGGVLLISEEGNKLVELPYLPFL
FT                   TYEYSALDQWRELQRLAEILLSAPFEAVGIVTKLSEDANETRRITLHSEPDSVTLIRYL
FT                   GSCFFLAILMAILSINAILIISKRQKNKVRLQRIGEYYDNCFNSKQPPMD"
     MVSFLTFRWK RPDNARYLPS IAKTGHRKLN ADEYQAIDSY LQNALSLMQP DRSHRSGQPA        60
     LSVKNDTVYT INHTINRFSV ATDESQYWRY YVDEMEIHLP ALLESFIKQQ NTIEIVQTTF       120
     MPLVIAVNGH FLKDYQQDLS IARIVKQTAQ ASIQKNGNSI ANFLYIRKET PEENRLRRST       180
     GILEGILMCI GLSLWFLALF MPTPILPWLM LAAVLFLITS FWLTFRSPSP RNILNISCFN       240
     GIPKRWGIFS ESEPEQRRNI SLGGIDLIYP SHWEPYVVRE LDQNTDVDIY TNCHVVQQGR       300
     YLSLHEEEKH YPYQRYRKNL ILVVFSICAM LVLYFYQPVS LSMRLSFAWL YGSNTQVITS       360
     VTELQNMPLK EGDVLRVKGI GMCYIPPRLN DNPGGIKHIF TAFDCTGIYW NNDSPLPIPE       420
     SDIIENASTL ITTVNEQLHP IERSRKTNSD LNEAIAKSGM TLLDNFSQVI LKTHNLCMDE       480
     IDCIRLKSAL VNLSNAEDWN DLLKQAERGK LNGTKVLLRS VSADALEKLI DTTTASFIYR       540
     EIDKISILLN SPSPGGVLLI SEEGNKLVEL PYLPFLTYEY SALDQWRELQ RLAEILLSAP       600
     FEAVGIVTKL SEDANETRRI TLHSEPDSVT LIRYLGSCFF LAILMAILSI NAILIISKRQ       660
     KNKVRLQRIG EYYDNCFNSK QPPMD                                             685
//

If you have problems or comments...

PBIL Back to PBIL home page