(data stored in ACNUC1104 zone)

EMBL: FN667741.YTFM

FN667741.YTFM        Location/Qualifiers
FT   CDS             347820..349562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0069"
FT                   /gene="ytfM"
FT                   /locus_tag="XBJ1_0341"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79491"
FT                   /db_xref="GOA:D3UYW3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79491.1"
FT                   /translation="MSRYPFIFVLCVSVATPSAYSANLRLKVEGLSGELEKNARVQLSN
FT                   ISTEEVAPDARFQARVEKAIQQGLRPLGYYDPTVEFTYQEKTPPSRPVLTANVTPGEPV
FT                   RVVEVNVDLEGSAKTDKDYAALIKKNMPKEGAILNHGEYEHFKGALNSLAVRKGYFDAV
FT                   MKKSELEVSQEQHKSYWNFDFDSGDRYRFGSVRYHGSQIRENYLNNLLPFKQGEYYTSD
FT                   QLAEFNSRLANTGWFNSVVVVPDFKVGHTSQDKLLPLDAFLVPSSANYVELGGGYATDV
FT                   GPRVKAKWKKPWLNSRGHSLSTNINLSAPEQVIDASYKMPLKSNPLEQYYELQTGYKRK
FT                   DINDTISDTATLNLSRNWDLFTGWQYGVNLRWSLSHFTQANVTNTTMLLYPGATVSRIR
FT                   QRGGTMPYWGDSQRYSIDFSDKTWDSNVDFLVLQAHHVWIRTYKDKHRFVVRGDLGWIE
FT                   TNEFNKVPPGLRFFAGGDRSIRGYKYQKISPKNSEGKLTGASKLAVGSLEYQYNIYGNW
FT                   WSALFVDTGEAVDDIKKSDFKTGAGIGVRWASPVGPIKFDLATPVGDASNHGIEFYIGL
FT                   GAEL"
     MSRYPFIFVL CVSVATPSAY SANLRLKVEG LSGELEKNAR VQLSNISTEE VAPDARFQAR        60
     VEKAIQQGLR PLGYYDPTVE FTYQEKTPPS RPVLTANVTP GEPVRVVEVN VDLEGSAKTD       120
     KDYAALIKKN MPKEGAILNH GEYEHFKGAL NSLAVRKGYF DAVMKKSELE VSQEQHKSYW       180
     NFDFDSGDRY RFGSVRYHGS QIRENYLNNL LPFKQGEYYT SDQLAEFNSR LANTGWFNSV       240
     VVVPDFKVGH TSQDKLLPLD AFLVPSSANY VELGGGYATD VGPRVKAKWK KPWLNSRGHS       300
     LSTNINLSAP EQVIDASYKM PLKSNPLEQY YELQTGYKRK DINDTISDTA TLNLSRNWDL       360
     FTGWQYGVNL RWSLSHFTQA NVTNTTMLLY PGATVSRIRQ RGGTMPYWGD SQRYSIDFSD       420
     KTWDSNVDFL VLQAHHVWIR TYKDKHRFVV RGDLGWIETN EFNKVPPGLR FFAGGDRSIR       480
     GYKYQKISPK NSEGKLTGAS KLAVGSLEYQ YNIYGNWWSA LFVDTGEAVD DIKKSDFKTG       540
     AGIGVRWASP VGPIKFDLAT PVGDASNHGI EFYIGLGAEL                             580
//

If you have problems or comments...

PBIL Back to PBIL home page