(data stored in ACNUC1104 zone)

EMBL: FN667742.ARGB

FN667742.ARGB        Location/Qualifiers
FT   CDS             234777..235550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0055"
FT                   /gene="argB"
FT                   /locus_tag="XNC1_0269"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88357"
FT                   /db_xref="GOA:D3VH72"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041731"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88357.1"
FT                   /translation="MVPLVIKLGGVLLDSEEALERLFTTLQLYRKTHKRPLVIVHGGGC
FT                   LVDEMMQKLQLPILKKQGLRVTPEDQIDIITGTLAGTANKKLLAWAIKLRLPAIGLCLG
FT                   DGGMVKVSQLDKTFGHTGMAIAGEPDLLKILLDVGYMPIISSIGITEHGELMNVNADQA
FT                   ATAIAQVLNADLVLLSDVSGILDGKGQKIPEATAEKIEQLIEQGIITDGMIVKVNAALD
FT                   AAKTLGQPVDIASWRHSEQLIALFNGIPVGTRILA"
     MVPLVIKLGG VLLDSEEALE RLFTTLQLYR KTHKRPLVIV HGGGCLVDEM MQKLQLPILK        60
     KQGLRVTPED QIDIITGTLA GTANKKLLAW AIKLRLPAIG LCLGDGGMVK VSQLDKTFGH       120
     TGMAIAGEPD LLKILLDVGY MPIISSIGIT EHGELMNVNA DQAATAIAQV LNADLVLLSD       180
     VSGILDGKGQ KIPEATAEKI EQLIEQGIIT DGMIVKVNAA LDAAKTLGQP VDIASWRHSE       240
     QLIALFNGIP VGTRILA                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page