(data stored in ACNUC1104 zone)

EMBL: FN667742.ATPD

FN667742.ATPD        Location/Qualifiers
FT   CDS             complement(28662..30044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpD"
FT                   /locus_tag="XNC1_0025"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   beta-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88118"
FT                   /db_xref="GOA:D3VG28"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88118.1"
FT                   /translation="MATGKIIQVIGAVVDVEFPQDSVPKVYDALEVKNGEEKLVLEVQQ
FT                   QLGGGIVRCIAMGTSDGLRRHLEVTDLGHPIEVPVGKATLGRIMNVLGDPIDMKGEIGE
FT                   EERWSIHRTAPTYEELSNSQELLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   IRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVAL
FT                   TGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQE
FT                   RITSTQTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDS
FT                   TSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEDDKLVVARARKIQR
FT                   FLSQPFFVAEVFTGSPGKFVPLKDTIRGFKGILNGDYDHLPEQAFYMVGTIEEAVEKAK
FT                   KL"
     MATGKIIQVI GAVVDVEFPQ DSVPKVYDAL EVKNGEEKLV LEVQQQLGGG IVRCIAMGTS        60
     DGLRRHLEVT DLGHPIEVPV GKATLGRIMN VLGDPIDMKG EIGEEERWSI HRTAPTYEEL       120
     SNSQELLETG IKVMDLICPF AKGGKVGLFG GAGVGKTVNM MELIRNIAIE HSGYSVFAGV       180
     GERTREGNDF YHEMTDSNVL DKVSLVYGQM NEPPGNRLRV ALTGLTMAEK FRDEGRDVLL       240
     FVDNIYRYTL AGTEVSALLG RMPSAVGYQP TLAEEMGVLQ ERITSTQTGS ITSVQAVYVP       300
     ADDLTDPSPA TTFAHLDATV VLSRQIASLG IYPAVDPLDS TSRQLDPLVV GQEHYDVARG       360
     VQSILQRYQE LKDIIAILGM DELSEDDKLV VARARKIQRF LSQPFFVAEV FTGSPGKFVP       420
     LKDTIRGFKG ILNGDYDHLP EQAFYMVGTI EEAVEKAKKL                             460
//

If you have problems or comments...

PBIL Back to PBIL home page