(data stored in ACNUC1104 zone)

EMBL: FN667742.ATPE

FN667742.ATPE        Location/Qualifiers
FT   CDS             complement(33638..33874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpE"
FT                   /locus_tag="XNC1_0030"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   c"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88123"
FT                   /db_xref="GOA:D3VG33"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88123.1"
FT                   /translation="MDINMDLLYIAAAILMGLAAIGAAIGIGILGGKFLEGAARQPDLI
FT                   PLLRTQFFIVMGLVDAIPMIAVGLGLFMMFAVA"
     MDINMDLLYI AAAILMGLAA IGAAIGIGIL GGKFLEGAAR QPDLIPLLRT QFFIVMGLVD        60
     AIPMIAVGLG LFMMFAVA                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page