(data stored in ACNUC1104 zone)

EMBL: FN667742.ATPG

FN667742.ATPG        Location/Qualifiers
FT   CDS             complement(30079..30942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpG"
FT                   /locus_tag="XNC1_0026"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   gamma-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88119"
FT                   /db_xref="GOA:D3VG29"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88119.1"
FT                   /translation="MAGAKEIRTKIASVQNTQKITKAMEMVAASKMRKTQDRMAASRPY
FT                   AETIRSVIGHLALGNLEYKHPYLEEREVKRVGYVVVSTDRGLCGGLNINLFKKLLIEMK
FT                   DWSDKNVQVDLALVGSKGVSFFSSVGGNIVAQVTGMGDNPSLSELIGPVHVMMQAYDEG
FT                   RLDKLYIVTNKFMNTMSQVPTITQLLPLPAGDDETLKKKSWDYLYEPDPKALLDTLLRR
FT                   YIESQVYQGVVENLASEQAARMVAMKAATDNGGNLIKELQLVYNKARQASITQELTEIV
FT                   SGASAV"
     MAGAKEIRTK IASVQNTQKI TKAMEMVAAS KMRKTQDRMA ASRPYAETIR SVIGHLALGN        60
     LEYKHPYLEE REVKRVGYVV VSTDRGLCGG LNINLFKKLL IEMKDWSDKN VQVDLALVGS       120
     KGVSFFSSVG GNIVAQVTGM GDNPSLSELI GPVHVMMQAY DEGRLDKLYI VTNKFMNTMS       180
     QVPTITQLLP LPAGDDETLK KKSWDYLYEP DPKALLDTLL RRYIESQVYQ GVVENLASEQ       240
     AARMVAMKAA TDNGGNLIKE LQLVYNKARQ ASITQELTEI VSGASAV                     287
//

If you have problems or comments...

PBIL Back to PBIL home page