(data stored in ACNUC1104 zone)

EMBL: FN667742.BTUB

FN667742.BTUB        Location/Qualifiers
FT   CDS             243252..245096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0057"
FT                   /gene="btuB"
FT                   /locus_tag="XNC1_0278"
FT                   /product="outer membrane porin: vitamin B12/cobalamin
FT                   transport, receptor for E colicins, bacteriophage BF23"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88366"
FT                   /db_xref="GOA:D3VH81"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88366.1"
FT                   /translation="MINKKQPFLSVISLVVFSCWSPVSIADNQDRLVVTANRFKQPISS
FT                   VLAPMTVVTREDIDRWQSNNLVDVLRRLPGVDIAQNGGLGQNSSLYVRGTNSSHTLVLV
FT                   DGIRLNQAGIMGAADFSQIPIAIVQRIEFIRGARSAVYGSDAIGGVINIITKRESRGTT
FT                   LNAGIGSNGYQNYNGSTQQKLGENTLLTAASGYTYTKGFDVIVDGKTGGYRQPDRDGFM
FT                   SKTLWLEIDHKINEQMSGFARTYGFNNRTAYDAGGIGGTDTRELFSRTYDAGLQFNQGI
FT                   YSSQLIASYSHVKDYNHAPDDGRYGKNTSLSDSKQYNVQWGNLWQVGHGAISSGVDWKR
FT                   ELVAAGSNYIPVQKSVDNTGLYLTAQQKIHDFTLEGAVRSDHHSEYDWNTTWQTGAGWE
FT                   FIDGYRLIVSYGTAFKAPTLGQLYGWGANPTLKPEKSKQWETGIEGLTGTLNWRLSAYR
FT                   NDIEQLIDYNIVTNHYRNLGQAKIRGVEWTGTMDTSIFQHQLTLQYIDPRDGNNKRLIR
FT                   RAKQQIKYQLDWEALNVDWGVTYQYIGPRHDLDYKVFPARTVKSGGVSLWDINASYPIT
FT                   DHLTIRAKIANLFDKNYETAYGYRTAGREYSLTGSYNF"
     MINKKQPFLS VISLVVFSCW SPVSIADNQD RLVVTANRFK QPISSVLAPM TVVTREDIDR        60
     WQSNNLVDVL RRLPGVDIAQ NGGLGQNSSL YVRGTNSSHT LVLVDGIRLN QAGIMGAADF       120
     SQIPIAIVQR IEFIRGARSA VYGSDAIGGV INIITKRESR GTTLNAGIGS NGYQNYNGST       180
     QQKLGENTLL TAASGYTYTK GFDVIVDGKT GGYRQPDRDG FMSKTLWLEI DHKINEQMSG       240
     FARTYGFNNR TAYDAGGIGG TDTRELFSRT YDAGLQFNQG IYSSQLIASY SHVKDYNHAP       300
     DDGRYGKNTS LSDSKQYNVQ WGNLWQVGHG AISSGVDWKR ELVAAGSNYI PVQKSVDNTG       360
     LYLTAQQKIH DFTLEGAVRS DHHSEYDWNT TWQTGAGWEF IDGYRLIVSY GTAFKAPTLG       420
     QLYGWGANPT LKPEKSKQWE TGIEGLTGTL NWRLSAYRND IEQLIDYNIV TNHYRNLGQA       480
     KIRGVEWTGT MDTSIFQHQL TLQYIDPRDG NNKRLIRRAK QQIKYQLDWE ALNVDWGVTY       540
     QYIGPRHDLD YKVFPARTVK SGGVSLWDIN ASYPITDHLT IRAKIANLFD KNYETAYGYR       600
     TAGREYSLTG SYNF                                                         614
//

If you have problems or comments...

PBIL Back to PBIL home page