(data stored in ACNUC1104 zone)

EMBL: FN667742.CPXA

FN667742.CPXA        Location/Qualifiers
FT   CDS             104765..106147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0020"
FT                   /gene="cpxA"
FT                   /locus_tag="XNC1_0110"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CpxR, regulates genes involved in
FT                   folding/degrading periplasmic proteins, senses changes in
FT                   the cell envelope"
FT                   /function="16.15 : Symbiosis"
FT                   /function="15.9 : Pathogenesis"
FT                   /EC_number="2.7.1.-"
FT                   /note="Evidence 1a : Function experimentally demonstrated
FT                   in the studied strain; PubMedId : 17951441; Product type r
FT                   : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88198"
FT                   /db_xref="GOA:D3VGA8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032404"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038515"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88198.1"
FT                   /translation="MINSLTARIFAIFWLTLALVLMVALMAPKLDSRQLTPLLDSEYQQ
FT                   GNKLAKQLEEELTRYPANDLFWWLRLDRAIAQLTPPGQSLLLVTSAGNIIDINTPTRQK
FT                   QVVRNFIGQSDNADHPKKKKYGRSEILGPFSIRDGEDHYQLYFVRPAGSPQSDFINLMF
FT                   DRPFLLPAATMLISAPLLLWLAWSLAKPARKLKNAADDVAKGNLRQHPELESGPQEFLA
FT                   TGSSFNQMISALERMVTAQQRLISDISHELRTPLTRLQLATALLRRRHGESKELARIET
FT                   ETQRLDGMINDLLVLSRNQHKNELLRENIKAYDIWHDILENAKFEVEQMNKTLDIVSPP
FT                   GAWVIYCNPATLGSALENIVRNALRYSDSHIAVAFKADNQGVTITVDDDGPGVSPEDRE
FT                   QIFRPFYRTDEARDRESGGTGLGLAIVETAISQHRGWVKAEDSPLGGLRLVIWLPLHGH
FT                   GR"
     MINSLTARIF AIFWLTLALV LMVALMAPKL DSRQLTPLLD SEYQQGNKLA KQLEEELTRY        60
     PANDLFWWLR LDRAIAQLTP PGQSLLLVTS AGNIIDINTP TRQKQVVRNF IGQSDNADHP       120
     KKKKYGRSEI LGPFSIRDGE DHYQLYFVRP AGSPQSDFIN LMFDRPFLLP AATMLISAPL       180
     LLWLAWSLAK PARKLKNAAD DVAKGNLRQH PELESGPQEF LATGSSFNQM ISALERMVTA       240
     QQRLISDISH ELRTPLTRLQ LATALLRRRH GESKELARIE TETQRLDGMI NDLLVLSRNQ       300
     HKNELLRENI KAYDIWHDIL ENAKFEVEQM NKTLDIVSPP GAWVIYCNPA TLGSALENIV       360
     RNALRYSDSH IAVAFKADNQ GVTITVDDDG PGVSPEDREQ IFRPFYRTDE ARDRESGGTG       420
     LGLAIVETAI SQHRGWVKAE DSPLGGLRLV IWLPLHGHGR                             460
//

If you have problems or comments...

PBIL Back to PBIL home page