(data stored in ACNUC1104 zone)

EMBL: FN667742.DAMX

FN667742.DAMX        Location/Qualifiers
FT   CDS             complement(63051..64022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0010"
FT                   /gene="damX"
FT                   /locus_tag="XNC1_0060"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88148"
FT                   /db_xref="GOA:D3VG58"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032899"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88148.1"
FT                   /translation="MDELKSEKKQKTETEFKPDTSDRRPPRSKSQSNQPKLAVSRQQMM
FT                   IGVGILVLLLLIIAISSALKSPTEHEKQQSSNAAEKSIDLSGSSTLSGNEQDIGQETPS
FT                   VPATHGTDSKTHDISLPPPINSTSSQSLPPATNTGSYNQRIELPGDISDALNQQQSNIN
FT                   HSVQSNMAPLQANPTKPVLTPPIEQTKLEKVTPPKIENKGREENQPKAATKPLTNHHQT
FT                   NKKPETGASGDLLKAPANRFTLQLSSASRSDTLIAFAKKHNLSHYKVYETKRDHKTWFI
FT                   LIHGNYSSVYDAKSAISSLPAEVQAKKPWVRKLQQVQQDLKK"
     MDELKSEKKQ KTETEFKPDT SDRRPPRSKS QSNQPKLAVS RQQMMIGVGI LVLLLLIIAI        60
     SSALKSPTEH EKQQSSNAAE KSIDLSGSST LSGNEQDIGQ ETPSVPATHG TDSKTHDISL       120
     PPPINSTSSQ SLPPATNTGS YNQRIELPGD ISDALNQQQS NINHSVQSNM APLQANPTKP       180
     VLTPPIEQTK LEKVTPPKIE NKGREENQPK AATKPLTNHH QTNKKPETGA SGDLLKAPAN       240
     RFTLQLSSAS RSDTLIAFAK KHNLSHYKVY ETKRDHKTWF ILIHGNYSSV YDAKSAISSL       300
     PAEVQAKKPW VRKLQQVQQD LKK                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page