(data stored in ACNUC1104 zone)

EMBL: FN667742.FLIY

FN667742.FLIY        Location/Qualifiers
FT   CDS             complement(489759..490547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0107"
FT                   /gene="fliY"
FT                   /locus_tag="XNC1_0570"
FT                   /product="cysteine transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88644"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88644.1"
FT                   /translation="MRKNIAKKLLSLLLAGATALAVSAPGYAGKDFDAIKASGVFKIGT
FT                   EGTYPPFTYHDTNNKLTGFDVDIAQEIAKRLNVKSEFMEVKWDGLIAGLDAKRFDAVIN
FT                   QVGITPERAAKYNFSIPYTTSQVVLITRNNNDVIKTFADIKGKRSAQSLTSNYGQLATS
FT                   YGANLVSTDGFNQAIDLVVTGRADATLNDRLSFLDFKKQRPDAPVKIVAQQADASKSAV
FT                   LVRKGDAELVKAINKALQEMKDDGTYARISGKYFGVDISK"
     MRKNIAKKLL SLLLAGATAL AVSAPGYAGK DFDAIKASGV FKIGTEGTYP PFTYHDTNNK        60
     LTGFDVDIAQ EIAKRLNVKS EFMEVKWDGL IAGLDAKRFD AVINQVGITP ERAAKYNFSI       120
     PYTTSQVVLI TRNNNDVIKT FADIKGKRSA QSLTSNYGQL ATSYGANLVS TDGFNQAIDL       180
     VVTGRADATL NDRLSFLDFK KQRPDAPVKI VAQQADASKS AVLVRKGDAE LVKAINKALQ       240
     EMKDDGTYAR ISGKYFGVDI SK                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page