(data stored in ACNUC1104 zone)

EMBL: FN667742.FRDA

FN667742.FRDA        Location/Qualifiers
FT   CDS             complement(550848..552644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0119"
FT                   /gene="frdA"
FT                   /locus_tag="XNC1_0638"
FT                   /product="fumarate reductase, anaerobic, catalytic and
FT                   NAD/flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88709"
FT                   /db_xref="GOA:D3VJF3"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88709.1"
FT                   /translation="MQTVNVDLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQSHDSHDFHFNDTVSGGDWLCEQDVVEYFVKHCPTEMIQLEQWGCPW
FT                   SRKEDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYSQIQRFDEHFVLDILV
FT                   DEGHARGLVALNMMEGTKVQIRANAVIMATGGAGRVYRYNTNGGIVTGDGMGMAFRHGV
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGLGPETPLGHPENK
FT                   YMELGPRDKVSQAFWHEWRAGRTVATPRGNVVYLDLRHLGEKKLLERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETNQRCETRIKGLFAIGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRLAAEEAVKHIQAVKPANESALNAQFRDVEDKLNQLLNQKGNESQAKIRDDLGT
FT                   SMEEGCGIYRTPELMQKTIDKIAELKERFKRIEINDRSSVFNTDLLYTIELGFGLDVAE
FT                   CMAHSAISRKESRGAHQRLDEGCTGRDDENFLKHTLAFYNPEGAPRLEYSDVKITKSQP
FT                   AKRVYGGEAAAQEKKQKEQVND"
     MQTVNVDLAI IGAGGAGLRA AIAAAEANPQ LKIALISKVY PMRSHTVAAE GGSAAVTQSH        60
     DSHDFHFNDT VSGGDWLCEQ DVVEYFVKHC PTEMIQLEQW GCPWSRKEDG SVNVRRFGGM       120
     KIERTWFAAD KTGFHMLHTL FQTSLKYSQI QRFDEHFVLD ILVDEGHARG LVALNMMEGT       180
     KVQIRANAVI MATGGAGRVY RYNTNGGIVT GDGMGMAFRH GVPLRDMEFV QYHPTGLPGS       240
     GILMTEGCRG EGGILVNKDG YRYLQDYGLG PETPLGHPEN KYMELGPRDK VSQAFWHEWR       300
     AGRTVATPRG NVVYLDLRHL GEKKLLERLP FICELAKAYV GVDPVKEPIP VRPTAHYTMG       360
     GIETNQRCET RIKGLFAIGE CSSVGLHGAN RLGSNSLAEL VVFGRLAAEE AVKHIQAVKP       420
     ANESALNAQF RDVEDKLNQL LNQKGNESQA KIRDDLGTSM EEGCGIYRTP ELMQKTIDKI       480
     AELKERFKRI EINDRSSVFN TDLLYTIELG FGLDVAECMA HSAISRKESR GAHQRLDEGC       540
     TGRDDENFLK HTLAFYNPEG APRLEYSDVK ITKSQPAKRV YGGEAAAQEK KQKEQVND         598
//

If you have problems or comments...

PBIL Back to PBIL home page