(data stored in ACNUC1104 zone)

EMBL: FN667742.FRDD

FN667742.FRDD        Location/Qualifiers
FT   CDS             complement(549341..549694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0119"
FT                   /gene="frdD"
FT                   /locus_tag="XNC1_0635"
FT                   /product="fumarate reductase, anaerobic, membrane anchor
FT                   polypeptide"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0635"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88706"
FT                   /db_xref="GOA:D3VJF0"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88706.1"
FT                   /translation="MNQVPKRSDEPIFWGLFGAGGMWSAIVGPAIILLLGILLPLGLAP
FT                   EALSYERILTFCQSFIGRLFLLLMISLPLWCGLHRIHHGMHDLQLHIPASKWVFYGAAA
FT                   ILSIVALIGVFTL"
     MNQVPKRSDE PIFWGLFGAG GMWSAIVGPA IILLLGILLP LGLAPEALSY ERILTFCQSF        60
     IGRLFLLLMI SLPLWCGLHR IHHGMHDLQL HIPASKWVFY GAAAILSIVA LIGVFTL          117
//

If you have problems or comments...

PBIL Back to PBIL home page