(data stored in ACNUC1104 zone)

EMBL: FN667742.FTSN

FN667742.FTSN        Location/Qualifiers
FT   CDS             complement(194079..194849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0047"
FT                   /gene="ftsN"
FT                   /locus_tag="XNC1_0221"
FT                   /product="essential cell division protein, epimerase-or
FT                   mutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88309"
FT                   /db_xref="GOA:D3VH24"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88309.1"
FT                   /translation="MAQRDYVSRGRTNPRQKSTGNKKNQSQGLPKTTLAVAVALVVMLI
FT                   GGLYFIVHSKKESVQNEPQPAHPSKGHGLPPKPEERWSYIKELENRPVNETSIPDPAAT
FT                   LNPPLNQATQLTPEQKQLLEQMQADMRQPPISLKEVPYNSDPVPRSRVVINPPAQENAQ
FT                   NQPEPSAQPVPAPKLTATESRVMLQCGSFRAAEQAESVRASLAFAGIESQITTKDNWNR
FT                   VVLGPYKNQAGAEKMRTRVAEAGVSGCILRPAGG"
     MAQRDYVSRG RTNPRQKSTG NKKNQSQGLP KTTLAVAVAL VVMLIGGLYF IVHSKKESVQ        60
     NEPQPAHPSK GHGLPPKPEE RWSYIKELEN RPVNETSIPD PAATLNPPLN QATQLTPEQK       120
     QLLEQMQADM RQPPISLKEV PYNSDPVPRS RVVINPPAQE NAQNQPEPSA QPVPAPKLTA       180
     TESRVMLQCG SFRAAEQAES VRASLAFAGI ESQITTKDNW NRVVLGPYKN QAGAEKMRTR       240
     VAEAGVSGCI LRPAGG                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page