(data stored in ACNUC1104 zone)

EMBL: FN667742.FTSX

FN667742.FTSX        Location/Qualifiers
FT   CDS             576769..577743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0123"
FT                   /gene="ftsX"
FT                   /locus_tag="XNC1_0664"
FT                   /product="integral membrane cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88735"
FT                   /db_xref="GOA:D3VJH9"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88735.1"
FT                   /translation="MVKPVRHSAKKTLPPKSKSLKGGWRVQRRYAWKSTLSDMLRQPLA
FT                   TLLTIMVIAISLTLPSVFYIVWKNVNQAVVQWYPIPQLTVYLDKSLNDNSAKGVIDQLK
FT                   SMEGVQSVNYLSREEAVNEFRAWSGFASALNLLEENPLPAVAIVSPKLNFQDSQAITAL
FT                   RDQVAQIKGIEEVRMDDSWFARLTALTSLIGRIAAVIGILMVVALLLVIGNSVRLSIFS
FT                   RRETINVMKLIGATDGFILRPFLNGGALLGILGAVFSLILSSLLVWKLSNVVMEVAGVF
FT                   GTSFKLHGLGWDESLLLVLIAGMIGWIAAWFATIQHLRRFRPE"
     MVKPVRHSAK KTLPPKSKSL KGGWRVQRRY AWKSTLSDML RQPLATLLTI MVIAISLTLP        60
     SVFYIVWKNV NQAVVQWYPI PQLTVYLDKS LNDNSAKGVI DQLKSMEGVQ SVNYLSREEA       120
     VNEFRAWSGF ASALNLLEEN PLPAVAIVSP KLNFQDSQAI TALRDQVAQI KGIEEVRMDD       180
     SWFARLTALT SLIGRIAAVI GILMVVALLL VIGNSVRLSI FSRRETINVM KLIGATDGFI       240
     LRPFLNGGAL LGILGAVFSL ILSSLLVWKL SNVVMEVAGV FGTSFKLHGL GWDESLLLVL       300
     IAGMIGWIAA WFATIQHLRR FRPE                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page