(data stored in ACNUC1104 zone)

EMBL: FN667742.GARK

FN667742.GARK        Location/Qualifiers
FT   CDS             579888..581021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garK"
FT                   /locus_tag="XNC1_0667"
FT                   /product="glycerate kinase I"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0667"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88738"
FT                   /db_xref="GOA:D3VJI2"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88738.1"
FT                   /translation="MRIVIAPDSFKESLSALQVAQAIEQGFKEIFPQANYITLPMADGG
FT                   EGTVDALVAATGGKRILCTVTDPLGQPVEAFFGLLGDGKTAVIEMAAASGLHLVPIEQR
FT                   NPLITTSYGTGELILAALEHDIQKLILGIGGSATNDGGAGMMQALGANLQDGDGRILPF
FT                   GGAALSRLENIELTGLDPRLNQLEITVACDVNNPLCGKLGASAVFGPQKGATPEMVNVL
FT                   DSALHHYGLKIESLMGKNVIDAAGAGAAGGMGASLLGCLGAKLRSGIEIIIDTLKLEET
FT                   IQGADLVITGEGRIDSQTIHGKTPIGVARVAQKLGVPTIALVGGMSRDYGAVHQHGIDA
FT                   VFSIVPEACSLSDALAHGAENLRVTARNVAAVWSISH"
     MRIVIAPDSF KESLSALQVA QAIEQGFKEI FPQANYITLP MADGGEGTVD ALVAATGGKR        60
     ILCTVTDPLG QPVEAFFGLL GDGKTAVIEM AAASGLHLVP IEQRNPLITT SYGTGELILA       120
     ALEHDIQKLI LGIGGSATND GGAGMMQALG ANLQDGDGRI LPFGGAALSR LENIELTGLD       180
     PRLNQLEITV ACDVNNPLCG KLGASAVFGP QKGATPEMVN VLDSALHHYG LKIESLMGKN       240
     VIDAAGAGAA GGMGASLLGC LGAKLRSGIE IIIDTLKLEE TIQGADLVIT GEGRIDSQTI       300
     HGKTPIGVAR VAQKLGVPTI ALVGGMSRDY GAVHQHGIDA VFSIVPEACS LSDALAHGAE       360
     NLRVTARNVA AVWSISH                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page