(data stored in ACNUC1104 zone)

EMBL: FN667742.GIDA

FN667742.GIDA        Location/Qualifiers
FT   CDS             complement(36436..38292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0005"
FT                   /gene="gidA"
FT                   /locus_tag="XNC1_0034"
FT                   /product="glucose-inhibited division protein,
FT                   oxidoreductase-like with FAD/NAD(P)-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88127"
FT                   /db_xref="GOA:D3VG37"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88127.1"
FT                   /translation="MFYPEHFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQM
FT                   SCNPAIGGIGKGHLVKEIDALGGLMAKATDQAGIQFRTLNASKGPAVRATRAQADRVLY
FT                   RQAVRTALENQPNLMIFQQPVEDLIVENNTVTGVVTRMSLKFKAKSVVLTVGTFLDGKI
FT                   HIGLENYSGGRAGDPPAISLSHRLRELPLRVARLKTGTPPRIDARSIDFSQLEQQLGDN
FT                   PTPVFSFMGNAAQHPQQILCYITHTNEKTHEVIRSNLDRSPMYAGIIEGIGPRYCPSIE
FT                   DKVMRFADRNAHQIFLEPEGLTSNEIYPNGISTSLPFDVQMQIVHSMKGMENARIIRPG
FT                   YAIEYDFFDPRGLKQTLESKFIHGLFFAGQINGTTGYEEAAAQGLLAGLNAARYATGEE
FT                   GWFPRRDQAYIGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTEQGRRLGLV
FT                   DDLRWKHYSRKVEMIEQERQRLRNIWVHPHSDNLGDINQMLKTPLSKEANGEDLLRRPE
FT                   MNYELLTSLSRFAPGLTEAQAADQVEIQVKYEGYIARQQEEIEKQLRNENTALPVDLDY
FT                   QQVSGLSNEVIAKLNDHKPSSIGQASRISGITPAAISILLVW"
     MFYPEHFDVI IIGGGHAGTE AAMAAARMGR QTLLLTHNID TLGQMSCNPA IGGIGKGHLV        60
     KEIDALGGLM AKATDQAGIQ FRTLNASKGP AVRATRAQAD RVLYRQAVRT ALENQPNLMI       120
     FQQPVEDLIV ENNTVTGVVT RMSLKFKAKS VVLTVGTFLD GKIHIGLENY SGGRAGDPPA       180
     ISLSHRLREL PLRVARLKTG TPPRIDARSI DFSQLEQQLG DNPTPVFSFM GNAAQHPQQI       240
     LCYITHTNEK THEVIRSNLD RSPMYAGIIE GIGPRYCPSI EDKVMRFADR NAHQIFLEPE       300
     GLTSNEIYPN GISTSLPFDV QMQIVHSMKG MENARIIRPG YAIEYDFFDP RGLKQTLESK       360
     FIHGLFFAGQ INGTTGYEEA AAQGLLAGLN AARYATGEEG WFPRRDQAYI GVLVDDLCTL       420
     GTKEPYRMFT SRAEYRLMLR EDNADLRLTE QGRRLGLVDD LRWKHYSRKV EMIEQERQRL       480
     RNIWVHPHSD NLGDINQMLK TPLSKEANGE DLLRRPEMNY ELLTSLSRFA PGLTEAQAAD       540
     QVEIQVKYEG YIARQQEEIE KQLRNENTAL PVDLDYQQVS GLSNEVIAKL NDHKPSSIGQ       600
     ASRISGITPA AISILLVW                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page