(data stored in ACNUC1104 zone)

EMBL: FN667742.GIDB

FN667742.GIDB        Location/Qualifiers
FT   CDS             complement(35772..36392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0005"
FT                   /gene="gidB"
FT                   /locus_tag="XNC1_0033"
FT                   /product="glucose-inhibited division protein, contains
FT                   S-adenosyl-L-methionine-dependent methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88126"
FT                   /db_xref="GOA:D3VG36"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88126.1"
FT                   /translation="MLNKLESLLAKTDIALSQEQKQQLVAYVEMLNKWNKAYNLTSVRD
FT                   PEQMLVRHIMDSIVVNPFLHGTRFIDVGTGPGLPGVPLAIVRQDSHFTLLDSLGKRVRF
FT                   LRQVQHELGLTNIDPVQSRVEEFIPEPPFDGVISRAFASLQDMLSWCRHLPKPLEGRFY
FT                   ALKGGLPEDELANLPTGFILDTVIPLQVTELDEQRHLVILKSN"
     MLNKLESLLA KTDIALSQEQ KQQLVAYVEM LNKWNKAYNL TSVRDPEQML VRHIMDSIVV        60
     NPFLHGTRFI DVGTGPGLPG VPLAIVRQDS HFTLLDSLGK RVRFLRQVQH ELGLTNIDPV       120
     QSRVEEFIPE PPFDGVISRA FASLQDMLSW CRHLPKPLEG RFYALKGGLP EDELANLPTG       180
     FILDTVIPLQ VTELDEQRHL VILKSN                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page