(data stored in ACNUC1104 zone)

EMBL: FN667742.HEMY

FN667742.HEMY        Location/Qualifiers
FT   CDS             complement(334766..335971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0074"
FT                   /gene="hemY"
FT                   /locus_tag="XNC1_0402"
FT                   /product="protein in late step of protoheme IX synthesis
FT                   with TPR-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88479"
FT                   /db_xref="GOA:D3VHZ0"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88479.1"
FT                   /translation="MLKILLLFIILIVGIILGPVMSGHQGYVLIQTDSNNITTSITAVV
FT                   IMFLLLQFLLIFIGWCYRRLKRTSTSTHSWIFGGFKRNRARSQTRQALLKLAEGDFKQV
FT                   EHLMTRNADHAEYPVVNYLLAAEAAQQRGDYFHTNQYIERAAEVADKDQLPVDISRVRI
FT                   QLAQGEIHAARNGVDKLLNHAPRHPEVLRLAERAYSLSGAYQALIDVLPSMIKAKLYDE
FT                   EKIHAIRQQAYVGLMNQVFAEKGCTGLKAWWKDQGRKIRQDIVLQVVMAEHLIACNDHD
FT                   TAQQIILDGLKQQYDERLLLLIPHLKANDAEAIQKNLTHLLKQHGATPLLNSTMGQVAL
FT                   RHGEWANAEAAFKAALAQRPDAHDYAWLADALDKLQKHEEATQTRSKGFMLTLKRDSNT
FT                   GA"
     MLKILLLFII LIVGIILGPV MSGHQGYVLI QTDSNNITTS ITAVVIMFLL LQFLLIFIGW        60
     CYRRLKRTST STHSWIFGGF KRNRARSQTR QALLKLAEGD FKQVEHLMTR NADHAEYPVV       120
     NYLLAAEAAQ QRGDYFHTNQ YIERAAEVAD KDQLPVDISR VRIQLAQGEI HAARNGVDKL       180
     LNHAPRHPEV LRLAERAYSL SGAYQALIDV LPSMIKAKLY DEEKIHAIRQ QAYVGLMNQV       240
     FAEKGCTGLK AWWKDQGRKI RQDIVLQVVM AEHLIACNDH DTAQQIILDG LKQQYDERLL       300
     LLIPHLKAND AEAIQKNLTH LLKQHGATPL LNSTMGQVAL RHGEWANAEA AFKAALAQRP       360
     DAHDYAWLAD ALDKLQKHEE ATQTRSKGFM LTLKRDSNTG A                           401
//

If you have problems or comments...

PBIL Back to PBIL home page